PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g04252.1.p
Common NameBRADI_2g04252, LOC100836853
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 278aa    MW: 29626.8 Da    PI: 6.1701
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g04252.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171865148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l+  ++++G  tW+++a+  g++R++k+c++rw +yl
  Bradi2g04252.1.p 18 KGLWSPEEDERLYARITRHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 65
                      678*******************************************97 PP

2Myb_DNA-binding40.66e-1373113345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + ++ E++ +v + k lG++ W+ Ia++m+ gRt++++k++w+
  Bradi2g04252.1.p  73 PISKREQDTIVSLQKSLGNR-WSVIAARMP-GRTDNEIKNYWN 113
                       568889**************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.0331369IPR017930Myb domain
SuperFamilySSF466891.15E-2717112IPR009057Homeodomain-like
SMARTSM007172.1E-121767IPR001005SANT/Myb domain
PfamPF002492.3E-141865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-201972IPR009057Homeodomain-like
CDDcd001679.03E-112165No hitNo description
PROSITE profilePS5129415.56870120IPR017930Myb domain
SMARTSM007174.2E-1270118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-2273119IPR009057Homeodomain-like
CDDcd001672.30E-973113No hitNo description
PfamPF002495.4E-1173114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MVEKTAGGHG AEAAKERKGL WSPEEDERLY ARITRHGVST WSSVAQLAGL RRSGKSCRLR  60
WMNYLRPDLK KEPISKREQD TIVSLQKSLG NRWSVIAARM PGRTDNEIKN YWNSRIRKRQ  120
SVVLTSSGDG GGANGDPPAA AAAETQHELA LAESPAGEKK EPFSAAAAPP AVPPARFPVF  180
ACQIPAGSAI NAAPQSTTTT AHEHNGAGSE SEVSVGGGEE HCYYYYRGGD GDMDMFGHLL  240
SFDDLEYPAA GAAGGDLLMD AWESQLYCAN SGGSSVD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-24181194104MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-241811927127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE6508361e-164HE650836.1 Brachypodium sylvaticum genomic construct, BACs 73P1 and 17E7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232989.10.0PREDICTED: myb-related protein Myb4
TrEMBLA0A0Q3FXC00.0A0A0Q3FXC0_BRADI; Uncharacterized protein
STRINGMLOC_19052.11e-106(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Representative plantOGRP1595433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.15e-47myb domain protein 50